PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009121157.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family Nin-like
Protein Properties Length: 896aa    MW: 99407 Da    PI: 4.7022
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009121157.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK887.8e-28610660252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+i l++l++yF++++kdAAk++gvc+T+LKriCR++GI RWP+Rkik++
  XP_009121157.1 610 EKTIGLDVLRQYFAGSLKDAAKSIGVCPTTLKRICRHHGITRWPSRKIKKV 660
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151916.836599680IPR003035RWP-RK domain
PfamPF020426.7E-24613660IPR003035RWP-RK domain
SuperFamilySSF542777.29E-24788883No hitNo description
Gene3DG3DSA:3.10.20.2401.5E-23796879No hitNo description
PROSITE profilePS5174526.065798881IPR000270PB1 domain
SMARTSM006663.0E-26798881IPR000270PB1 domain
PfamPF005644.9E-16799880IPR000270PB1 domain
CDDcd064074.76E-43799880No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 896 aa     Download sequence    Send to blast
MGLDMEDDGG SDGGEGNGGF SPNSSFGAFP ETAMDLDFMD ELLFDGCWLE TTDSKSLKET  60
EEAASDSTAM NANSSFLCFG ENPSQDNFSN EETERMNQEG FDQAEKFLLD EAEVGRSWWI  120
APRTREDPCS SVKERLLRAI SGLEEAVPDK DFLVQIWVPF QQEGKNFLTT LAQPHLFNQK  180
YSSLAKYRHV SETYNFPADE GSTEGGLPGR VFLQKFPEWT PDVRFFRSDE YPRIKEAQKC  240
DVRGSLALPV FERCSGTCLG VVEVVTTTQK MNYRPELENI CKALEAVDLR SSSNLKPPNN  300
EVYNDFYYAA LPEISDFLAS VCRRYDLPLA LSWAPCAQQG KGGSRHSDEN FSQCVSTIDS  360
ACFVLDEESK YFLEACSEHH LLQGEGIVGK AFKATKLCFV PEVTTFSKTN YPLAHHAKIS  420
GLHAALAVPL KSKCNGLVEF VLEFFFPKGC LDTEAKQEML KSLSATLQQD FRSSNLVIDK  480
DLELEVVLPV REDMVLSENP LTGAETAEAL REIHLLQESS WISHMIKANE KGKDVSLSWE  540
YQNEDPKDEF KLSPGWDNSQ LDPAPNNIPS EAEQFQQGST PGLRVDAGPS TESASTGGRR  600
PGEKRRTKTE KTIGLDVLRQ YFAGSLKDAA KSIGVCPTTL KRICRHHGIT RWPSRKIKKV  660
GHSLKKLQLV MDSVQGAQGS IPLDSFYTSF PELSSPNISS NGSSLKNNEQ LHHYNVPIEN  720
GGPGEDKPAP RSPSSSCSGS NTNTPNADGV VKEAHSEAEL QNGNQEETKC LARTQSHNIF  780
KEPPLPGSSK MSFRDGGGIK VKATFGEAII RFTLLPSWGY TELQQEITRR FNIVDVSWFD  840
LKYLDDDEEW VLLTCEADLE ECIDIYRSSQ SQTIKISLHD PFQVKLGGSF GSSGPS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009121157.10.0PREDICTED: protein NLP1 isoform X2
RefseqXP_013666608.10.0PREDICTED: protein NLP1-like isoform X2
SwissprotQ8H1110.0NLP1_ARATH; Protein NLP1
TrEMBLM4CCU40.0M4CCU4_BRARP; Uncharacterized protein
STRINGBra002025.1-P0.0(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.10.0Nin-like family protein